PatentDe  


Dokumentenidentifikation DE102006012207A1 20.09.2007
Titel Hochgeschwindigkeits-flammgespritzte Golfschlägerbeschichtung
Anmelder Linde AG, 65189 Wiesbaden, DE
Erfinder Heinrich, Peter, 82110 Germering, DE
DE-Anmeldedatum 16.03.2006
DE-Aktenzeichen 102006012207
Offenlegungstag 20.09.2007
Veröffentlichungstag im Patentblatt 20.09.2007
IPC-Hauptklasse C23C 4/10(2006.01)A, F, I, 20060316, B, H, DE
IPC-Nebenklasse A63B 53/04(2006.01)A, L, I, 20060316, B, H, DE   
Zusammenfassung Die Erfindung betrifft einen Golfschläger mit einer Schlagfläche, auf die zumindest bereichsweise durch Hochgeschwindigkeits-Flammspritzen eine metallgebundene Carbidbeschichtung aufgebracht wurde. Erfindungsgemäß haben die Carbidpartikel Größen zwischen 0,6 und 3 µm, wodurch sich eine Rauigkeit Ra der Beschichtung von 1,4 bis 1,9 µm ergibt.

Beschreibung[de]

Die Erfindung betrifft einen Golfschläger mit einer Schlagfläche zum Schlagen von Golfbällen. Die Erfindung betrifft ferner ein Verfahren zum Beschichten eines Golfschlägers zumindest im Bereich der Schlagfläche mittels eines thermischen Spritzverfahrens.

Glatte Schlagflächen haben den Nachteil, dass dem Golfball kein ausreichender Drall mitgegeben wird, so dass die Schlaglänge nicht ausreichend ist. Es wird daher häufig die Schlagfläche mit Sandstrahlen aufgeraut, um eine bessere Griffigkeit der Schlagfläche zu erreichen. Die durch Sandstrahl erreichte Rauigkeit hat allerdings keine hohe Lebensdauer. Insbesondere bei öfteren Abschlägen aus dem Sandbunker wird die so behandelte Oberfläche schnell wieder zu glatt.

Aus der WO 97/20961 ist die Beschichtung von Schlagflächen von Golfschlägern nach vorangegangener Strukturierung mittels Flammspritzens oder mittels Plasmaspritzens bekannt. Die Beschichtung kann aus metallgebundenen Karbiden (Cermets) oder Oxiden (keramische Verbindungen) bestehen. Die Rauigkeit der Schlagfläche wird gemäß Anspruch 4 mit ca. 140 bis 160 &mgr; inch angegeben, was einer Rauigkeit von 3,5 bis 4 &mgr;m entspricht. Die Beschichtung wird dort als hart, homogen aufgebaut, verschleißfest und mit rauher Oberfläche versehen charakterisiert. Bei den so hergestellten Beschichtungen kann es jedoch zu Rissbildungen kommen, was die Standzeiten bzw. die Lebensdauer der beschichteten Schlagfläche begrenzt.

Aus der US 4,768,787 ist eine Schlagfläche für Golfschläger bekannt, bei der Hartpartikel in einer weicheren Metallmatrix eingebettet sind und diese überragen. Diese Konstruktion hat sich – wie in der WO 97/20961 ausführlich beschrieben – als unpraktikabel erwiesen (Schlagenergie wird absorbiert, die Haltbarkeit ist nur gering).

Aus der EP 925 810 A1 oder der EP 1 062 990 A1 ist es bekannt, Schlagflächen von Golfschlägern durch Hochgeschwindigkeits-Flammspritzen zu beschichten.

Beim Hochgeschwindigkeits-Flammspritzen oder auch HVOF-Spritzen (High Veloctiy Oxygen Fuel) werden verschiedene Verfahrensgenerationen unterschieden:

Das Hochgeschwindigkeits-Flammspritzen der ersten Generation und das Hochgeschwindigkeits-Flammspritzen der zweiten Generation mit mittleren Spritzpartikelgeschwindigkeiten zwischen 400 und 450 m/s und seit 1992 bzw. 1994 das Hochgeschwindigkeits-Flammspritzen der dritten Generation mit mittlere n Spritzpartikelgeschwindigkeiten über 500 m/s. Systeme der dritten Generation des Hochgeschwindigkeits-Flammspritzens, mit denen die geforderten Geschwindigkeiten erreicht werden können, sind beispielsweise unter den Bezeichnungen JP 5000, DJ 2600, DJ 2700, Top Gun K und OSU Carbid Jet System bekannt.

Als Spritzmaterialien sind dort u.a. metallgebundene Carbide wie WC-Co, WC-CoCr, Cr3C2-NiCr und dergleichen angegeben. Solche Stoffe werden auch als Cermets (Kunstwort aus Keramik und Metall) bezeichnet.

Als Partikelgrößen der zu verspritzenden Pulver sind in beiden Literaturstellen die Größenordnungen von 1 &mgr;m bis 1 mm, besonders bevorzugt von 5 bis 100 &mgr;m angegeben.

Aufgabe der Erfindung ist es, eine Beschichtung für Schlagflächen vorzuschlagen, die eine definierte Rauheit aufweisen und diese über eine hohe Standzeit behalten.

Diese Aufgabe wird erfindungsgemäß gelöst von einem Golfschläger mit den Merkmalen des Anspruchs 1. Ausführungen der Erfindung und Verfahren zur Herstellung solcher Golfschläger sind Gegenstände von Unteransprüchen.

Erfindungsgemäß werden also Pulver verspritzt, die von der Werkstoffauswahl und von ihrem Größenspektrum her enge Auswahlen aus den bisher bekannten Stoffen und Größenklassen bilden. Von Werkstoffseite her wird nur Carbid, bevorzugt Wolframcarbid, besonders bevorzugt WCCo 88/12, verwendet. Von der Größenordnung her werden nur kleine Pulver mit den Größenordnungen zwischen 0,6 und 3 &mgr;m eingesetzt. Diese feinen Pulver sorgen für eine ausgeglichene, gleichmäßige Rauheit der Beschichtung der Schlagfläche mit den Rauigkeitswerten Ra zwischen 1,4 und 1,9 &mgr;m. Die Rauigkeit ist hier als mittlere Rauigkeit angegeben, die in der Literatur durch das Symbol Ra angegeben wird. Sie bezeichnet den mittleren Abstand eines Messpunktes auf der Oberfläche zum Mittelwert der Oberflächenhöhe und entspricht damit dem arithmetischen Mittel der Abweichung. In zwei Dimensionen berechnet sie sich aus:

wobei der Mittelwert durch
berechnet wird.

Etwas leichter vorstellbar ist die mittlere Rauigkeit (in einer Dimension) als die Höhe des Rechtecks, das die gleiche Länge wie die zu untersuchende Strecke und den gleichen Flächeninhalt wie jene Fläche zwischen Bezugshöhe und Profil hat.

In einer Ausführung der Erfindung werden nur Pulver zwischen 0,8 und 2,5 &mgr;m verwendet. Diese nochmals kleinere Auswahl führt zu einer nochmals feineren und gleichmäßigeren Rauheit der beschichteten Schlagflächen.

In einem bevorzugten Beispiel werden Pulver nur zwischen 0,8 und 1 &mgr;m verwendet. Durch diese extrem schmalbandige Auswahl an Pulverpartikeln wird eine sehr gleichmäßige Schlagoberfläche mit definierter Rauheit erzeugt. Das Gleiche gilt für eine weitere Ausführung der Erfindung, bei der ausschließlich Pulver mit Carbidgrößen zwischen 2,0 und 2,5 &mgr;m verwendet werden.

Durch die erfindungsgemäße Verwendung kleiner Pulver und Carbidgrößen ergibt sich eine äußerst gleichmäßige Schlägerschicht, die aussieht wie sandgestrahlt für optische Zwecke, jedoch wesentlich länger haltbar ist. Die Rauigkeit wird nämlich nicht durch Sandstrahlen oder andere abbrasive Methoden erzeugt, sondern durch gezielten Einsatz von Hartmetallpartikeln in einer Hochgeschwindigkeits-flammgespritzten Schicht.

Als Brenngase für das Hochgeschwindigkeits-Flammspritzen können die dafür vorgesehenen Gase wie Propan-Sauerstoff, Propen-Sauerstoff, Wasserstoff-Sauerstoff oder, besonders bevorzugt, Ethen-Sauerstoff verwendet werden. Als Fördergase werden Stickstoff oder Argon eingesetzt. Aufgrund der benötigten Brenngasdrucke (maximal 7 bar) beim Hochgeschwindigkeits-Flammspritzen werden bevorzugt langsam verbrennende Brenngase zum Einsatz kommen. Dies sind vorwiegend Ethen oder Propan.

In einer Ausführung der Erfindung wird ein Kühlen mit CO2 beim thermischen Spritzen eingesetzt. Gerade bei dem hochenergetischen Spritzverfahren des Hochgeschwindigkeits-Flammspritzens kann der Wärmeeintrag in den Grundwerkstoff sehr hoch sein. Beim Beschichten dünnwandiger oder schlecht wärmeleitender Substrate, aber auch bei der Beschichtung mit temperaturempfindlichen Werkstoffen können sich ohne Kühlung Probleme ergeben. Mit der CO2-Kühlung können bisher nicht beherrschbare Schichten gespritzt werden. Kohlendioxid (CO2) wird mit hohem Druck (ca. 57 bar) einem Druckbehälter entnommen. Üblicherweise kommt dabei eine Tankversorgung zum Einsatz, jedoch kann die Versorgung für kleinere oder sporadische Anwendungen auch über Flaschenbündel erfolgen. Die CO2-Düse ist so auf das Werkstück ausgerichtet, dass sie dem Bereich, der von der Spritzpistole beschichtet wurde, kurze Zeit später erreicht und diesen dadurch abkühlt.


Anspruch[de]
Golfschläger mit einer Schlagfläche, auf die zumindest bereichsweise durch Hochgeschwindigkeits-Flammspritzen eine metallgebundene Carbidbeschichtung aufgebracht wurde, dadurch gekennzeichnet, dass die Carbidpartikel Größen zwischen 0,6 und 3 &mgr;m haben, wodurch sich eine Rauigkeit Ra der Beschichtung von 1,4 bis 1,9 &mgr;m ergibt. Golfschläger nach Anspruch 1, dadurch gekennzeichnet, dass die Größe der Carbidpartikel zwischen 0,8 und 2,5 &mgr;m liegt. Golfschläger nach Anspruch 1, dadurch gekennzeichnet, dass die Größe der Carbidpartikel zwischen 0,8 und 1 &mgr;m liegt. Golfschläger nach Anspruch 1, dadurch gekennzeichnet, dass die Größe der Carbidpartikel zwischen 2,0 und 2,5 &mgr;m liegt. Verfahren zur Herstellung eines Golfschlägers eines der vorhergehenden Ansprüche, dadurch gekennzeichnet, dass Ethen als Brenngas eingesetzt werden. Verfahren zur Herstellung eines der Golfschläger nach einem der Ansprüche 1 bis 4, dadurch gekennzeichnet, dass mit Kohlendioxid gekühlt wird.






IPC
A Täglicher Lebensbedarf
B Arbeitsverfahren; Transportieren
C Chemie; Hüttenwesen
D Textilien; Papier
E Bauwesen; Erdbohren; Bergbau
F Maschinenbau; Beleuchtung; Heizung; Waffen; Sprengen
G Physik
H Elektrotechnik

Anmelder
Datum

Patentrecherche

Patent Zeichnungen (PDF)

Copyright © 2008 Patent-De Alle Rechte vorbehalten. eMail: info@patent-de.com